Creative Biolabs

Chemically-modifiedβ-Amyloid Peptide, 1-40 aa

[CAT#: NPP2012025CR]

Unconjugated peptide for APPI

Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer's disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
Length
40AA
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Amino Acids
ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL
HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL
GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL
GLY-GLY-VAL-VAL
Construction
1-40 aa
Molecule Mass
4329.82
Conjugation
Unconjugated
Molecular Formula
C194H295N53O58S1
Relevant Diseases
Neurological Disorders; Alzheimer's Disease; Prion Disease
Application Notes
T-cell assays; Immune monitoring; Antigen specific T-cell stimulation; T-cell expansion; Cellular immune response
Research Areas
Neuropeptide
Form
Powder
Quality
The contents of this vial have been accurately determined.
Purity
>95%, as determined by SDS-PAGE
Shipping
The product is shipped at 4°C. Upon receipt, store it immediately at the temperature recommended below.
Storage
Store in freezer(-20°C). Store away from oxidizing agents. Protect from heat. Keep container tightly sealed.
Handling Advice
Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
APPI
Official Name
APPI
Full Name
Beta-amyloid
Alternative Names
APP; AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2; amyloid beta precursor protein; preA4; Amyloid peptide; amyloid beta protein; beta amyloid plaques
Gene ID
351(Human); 11820(Mouse)
Uniprot ID
P05067(Human); P12023(Mouse)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare