Creative Biolabs

Human α-syn-E46K PFF

[CAT#: NPP-2106-S16]

Human α-syn Peptide

Species:
Human
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Pre-Formed Fibrils, E46K α-Synuclein (α-syn-E46K PFFs)
Species
Human
Expression Host
E. coli
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Form
Liquid
Formulation
10mM KPB pH 7.4
Purity
>95 %, purified by ion-exchange chromatography followed by reverse phase chromatography
Storage
Store at -20°C
Research Use Only
Research Use Only
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
CD14
Gene ID
6622 (Human); 20617 (Mouse)
Neural Cell Lines
Kits
Neural Genes
Neural Proteins & Peptides
Neural Antibodies
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare