Tel:
Fax:
Email:
Creative Biolabs

Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA) transcript variant 4 (NM_007308) ORF clone, Myc-DDK Tagged

[CAT#: NEP-0521-R0851]

Human Alpha-Synuclein (NM_007308) ORF clone, Myc-DDK Tagged

Target:
Alpha Synuclein
Gene/Insert name:
SNCA
Type:
Expression Vector/ Viral Particle

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Inquiry
Product Overview

Description

This is a human SNCA Myc-DDK tagged ORF clone expression plasmid, ready for transfecting into mammalian cells.

Gene/Insert Name

SNCA

Species

Human

Insert Size (bp)

336 bp

Tag

Myc-DDK

Type

Expression Vector/ Viral Particle

Vector

pCMV6

Vector Type

CMV

Virus Type

CMV

E. coli Selection

Kanamycin (25 ug/mL)

Cell Selection

Neomycin

ORF Nucleotide Sequence

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAGAAAACCAAACAGGGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTAGGCTCCAAAACCAAGGAGGGAGTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAAGAGCAAGTGACAAATGTTGGAGGAGCAGTGGTGACGGGTGTGACAGCAGTAGCCCAGAAGACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCTTTGTCAAAAAGGACCAGTTGGGCAAGGAAGGGTATCAAGACTACGAACCTGAAGCCACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGACGATAAGGTTTAA

Protein Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV

Restriction Sites

SgfI-MluI

Application Notes

The clone can express a complete ORF with a certain tag. Different ways of expression depend on the specific nature of the gene.

Purification

Ion-exchange column purified

Research Areas

Neural Signal Transduction; Metabolism; Neurotransmission

Relevant Diseases

Parkinson's Disease; Neurological Disorders

Key Components

Transfection-ready dried plasmid DNA
Properties

Soluble In

Sterile water

Appearance

Solid

Shipping

Keep in suitable, closed containers for shipping.

Handling Advice

Avoid breathing vapors, mist or gas.

Storage

Store the suspended plasmid at-20°C. The DNA is stable for at least one year from date of shipping when stored at-20°C

Research Use Only

For research use only
Target Details

Target

Alpha Synuclein

Official Name

SNCA

Full Name

Alpha-synuclein

Alternative Names

SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha

Gene ID

6622(Human)

Uniprot ID

P37840(Human)
Publications

Publications (0)

gift-card

Related Products
Neural Genes
Kits
Neural Antibodies
For Research Use Only. Not For Clinical Use.
Products
Hot Products
Fill out this form for a quote Inquiry Form Send Inquiry
USA

Tel:

Fax:

Email:

UK

Tel:

Email:

Germany

Tel:

Email:

Inquiry Basket
compare

Send inquiry