Creative Biolabs

Mouse Anti-BDNF Monoclonal Antibody (3C11), Unconjugated

[CAT#: NAB-0720-Z6083]

BDNF Mouse Monoclonal Antibody

Host Species:
Mouse
Species Reactivity:
Mouse; Rat; Human
Applications:
IHC-P; WB; ICC; IF

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
Recombinant full length protein corresponding to Human BDNF aa 129-247. Full length mature form without signal peptide or propeptide. Produced in E coli.
Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGW RFIRIDTSCVCTLTIKRGR
Database link: P23560
Species Reactivity
Mouse; Rat; Human
Clonality
Monoclonal
Host Species
Mouse
Isotype
IgG1
Clone Number
3C11
Applications
IHC-P; WB; ICC; IF
Relevant Diseases
Huntington's Disease
Pathways
Huntington's Disease Signaling
Conjugation
Unconjugated
Formulation
pH: 7.40
Preservative: 0.1% Sodium azide
Constituent: 99% PBS
Purification
Protein G purified
Purity
>95%
Shipping
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage
12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes: avoid repeated freeze-thaw cycles.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
BDNF
Official Name
BDNF
Full Name
Brain Derived Neurotrophic Factor
Alternative Names
Brain Derived Neurotrophic Factor; Neurotrophin; Abrineurin; Brain-Derived Neurotrophic Factor; ANON2; BULN2;
Gene ID
627 (Human); 12064 (Mouse); 24225 (Rat)
Uniprot ID
P23560 (Human); P21237 (Mouse); P23363 (Rat)
Neural Antibodies
Neural Proteins & Peptides
Kits
Biomaterials
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare