Creative Biolabs

NeuroMab™ Anti-DAB1 Antibody, Lot: NP1943

[CAT#: NRZP-0822-ZP4072]

Host Species:
Rabbit
Species Reactivity:
Human; Mouse; Rat
Applications:
ICC; IF

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKL
Species Reactivity
Human; Mouse; Rat
Host Species
Rabbit
Isotype
IgG
Applications
ICC; IF
Conjugation
Unconjugated
Purification
Protein A or G purified
Storage
Store at -20°C. Do not aliquot the antibody.
Research Use Only
For research use only
Target
DAB1
Official Name
DAB1
Full Name
DAB adaptor protein 1
Alternative Names
SCA37
Gene ID
1600(Human)
Uniprot ID
O75553(Human)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare