Creative Biolabs

NeuroMab™ Anti-DAB1 Antibody, Lot: NP2285

[CAT#: NRZP-0822-ZP4517]

Host Species:
Mouse
Species Reactivity:
Human
Applications:
WB

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
DAB1 (AAH67445.1, 1 a.a. - 553 a.a.) full-length human protein. MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS
Species Reactivity
Human
Host Species
Mouse
Isotype
IgG
Applications
WB
Conjugation
Unconjugated
Purification
Protein A or G purified
Storage
Store at -20°C. Do not aliquot the antibody.
Research Use Only
For research use only
Target
DAB1
Official Name
DAB1
Full Name
DAB adaptor protein 1
Alternative Names
SCA37
Gene ID
1600(Human)
Uniprot ID
O75553(Human)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare