Creative Biolabs

NeuroMab™ Anti-Kv3.3 Antibody, Clone N3764P

[CAT#: NRZP-0822-ZP4325]

Host Species:
Mouse
Species Reactivity:
Human
Applications:
WB; ELISA; S-ELISA

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Species Reactivity
Human
Clonality
Monoclonal
Host Species
Mouse
Isotype
IgG2b Kappa
Clone Number
N3764P
Applications
WB; ELISA; S-ELISA
Conjugation
Unconjugated
Purification
Protein A or G purified
Storage
Store at -20°C. Do not aliquot the antibody.
Research Use Only
For research use only
Target
KCNC3
Official Name
KCNC3
Full Name
potassium voltage-gated channel subfamily C member 3
Alternative Names
KSHIIID; KV3.3; SCA13; Voltage-gated potassium channel subunit Kv3.3; Potassium voltage-gated channel subfamily C member 3
Gene ID
3748(Human)
Uniprot ID
Q14003(Human)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare