Creative Biolabs

NeuroMab™ Anti-mGluR1 Antibody, Lot: NP2083

[CAT#: NRZP-0822-ZP4216]

Host Species:
Rabbit
Species Reactivity:
Human
Applications:
IHC; IHC-P

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQQQPPPQQKSLMDQ
Species Reactivity
Human
Host Species
Rabbit
Isotype
IgG
Applications
IHC; IHC-P
Conjugation
Unconjugated
Purification
Protein A or G purified
Storage
Store at -20°C. Do not aliquot the antibody.
Research Use Only
For research use only
Target
GRM1
Official Name
GRM1
Full Name
glutamate metabotropic receptor 1
Alternative Names
MGLU1; SCA44; GPRC1A; MGLUR1; SCAR13; PPP1R85
Gene ID
2911(Human)
Uniprot ID
Q13255(Human)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare