Creative Biolabs

Neuropeptide Y, 1-36 aa

[CAT#: NPP2012029CR]

Unconjugated peptide for NPY

Sequence:
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Length
36AA
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Amino Acids
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala
Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu
Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
Construction
1-36 aa
Molecule Mass
4272.7
Conjugation
Unconjugated
Molecular Formula
C189H284N54O58S1
Relevant Diseases
Neurological Disorders; Prion Disease
Application Notes
T-cell assays; Immune monitoring; Antigen specific T-cell stimulation; T-cell expansion; Cellular immune response
Research Areas
Neuropeptide
Form
Powder
Quality
The contents of this vial have been accurately determined.
Purity
>95%, as determined by SDS-PAGE
Shipping
The product is shipped at 4°C. Upon receipt, store it immediately at the temperature recommended below.
Storage
Store in freezer(-20°C). Store away from oxidizing agents. Protect from heat. Keep container tightly sealed.
Handling Advice
Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Neuropeptide Y
Official Name
NPY
Full Name
Neuropeptide Y (1-36)
Alternative Names
Neuropeptide Y (1-36)
Gene ID
4852(Human); 109648(Mouse); 24604(Rat)
Uniprot ID
P01303(Human); P57774(Mouse); P07808(Rat)
1. Wang F., et al. Reshaping Antibody Diversity. Cell. 2013 Jun;153(6):1379-93.
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare