Creative Biolabs

Recombinant Human Alpha-synuclein [mutated A53T] Protein [AA 1 to 140], Active

[CAT#: NPR2008PZ268]

Species:
Human
Sequence:
1 to 140

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
NP_000336.1
Species
Human
Expression Host
Escherichia coli
Length
Full length protein
Nature
Recombinant
Sequence
1 to 140
Amino Acids
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Accession Number
P37840
Molecule Mass
14 kDa
Applications
FuncS; SDS-PAGE; WB
Research Areas
Neurodegeneration
Pathways
Alzheimer's Disease Signaling
Marker
Tangles & Tau
Form
Liquid
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Shipping
Shipped on Dry Ice. Store at -80°C.
pH: 7.40Constituent: PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
This protein is filter sterilized prior to aliquoting and lyophilization. All aliquoting and lyophilization steps are performed in a sterile environment.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse)
Uniprot ID
P37840 (Human); P37840 (Mouse)
Neural Cell Lines
Kits
Neural Genes
Neural Antibodies
Neural Proteins & Peptides
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare