Creative Biolabs

Recombinant Human Alpha Synuclein Pre-formed Fibrils (Type 2) Protien

[CAT#: NPP2007FY54]

Species:
Human
Tag:
No tag

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Active human recombinant α-synuclein prefabricated fibrils (type 2)
Species
Human
Biological Activity
Does not induce Lewy body inclusion formation in Sprague-Dawley rat primary hippocampal neurons. Thioflavin T emission curve shows only a small increase in fluorescence (indicative of alpha synuclein aggregation) when Type 2 alpha synuclein PFFs are combined with alpha synuclein monomers. Certain biological activities in other neuronal cells cannot be ruled out. Researchers should test compatibility prior to use.
Expression Host
E. coli
Length
Full Length
Nature
Recombinant
Amino Acids
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Accession Number
NP_000336.1
Molecule Mass
~14.46 kDa
Tag
No tag
Conjugation
Unconjugated
Relevant Diseases
Alzheimer's Disease; Parkinson's Disease
Applications
WB; SDS-PAGE
Research Areas
Neuroregeneration
Form
Liquid
Formulation
PBS pH7.4
Carrier Protein
Preservative Free
Purification
Ion-exchange Purified
Purity
>95%
Shipping
Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Storage
-80°C
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson disease familial 1 Protein; SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse)
Uniprot ID
P37840 (Human); P37840 (Mouse)
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013).
2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.
3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.
4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.
5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.
Neural Vectors
Neural Proteins & Peptides
Kits
Animal Models
Neural Antibodies
Neural Cell Lines
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare