Creative Biolabs

Recombinant Human Alpha-synuclein Protein [AA 1 to 140]

[CAT#: NPR2008PZ303]

Species:
Human
Sequence:
1 to 140

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Species
Human
Expression Host
Escherichia coli
Length
Full length protein
Nature
Recombinant
Sequence
1 to 140
Amino Acids
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Accession Number
P37840
Molecule Mass
15 kDa
Applications
FuncS; SDS-PAGE; WB
Research Areas
Neurodegeneration
Pathways
Alzheimer's Disease Signaling
Marker
Tangles & Tau
Form
Liquid
Concentration
100 µg at 2 mg/ml
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Endotoxin Level
< 10 Eu/µg
Shipping
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituent: PBS0.2µm filtered solution
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
This protein is filter sterilized prior to aliquoting and lyophilization. All aliquoting and lyophilization steps are performed in a sterile environment.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse)
Uniprot ID
P37840 (Human); P37840 (Mouse)
Neural Cell Lines
Neural Antibodies
Neural Proteins & Peptides
Kits
Neural Genes
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare