Creative Biolabs

Recombinant Human Alpha Synuclein Protein Monomer (Type 1) Protien

[CAT#: NPP2007FY55]

Species:
Human
Tag:
No tag

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Active human recombinant alpha-synuclein protein monomer (type 1)
Species
Human
Biological Activity
100 µM alpha synuclein protein monomer seeded with 10µM alpha synuclein protein pre-formed fibrils in 25 µM Thioflavin T (PBS pH 7.4, 100 µl reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450 nm and emission at 485 nm on a Molecular Devices Gemini XPS microplate reader.
Expression Host
E. coli
Length
Full Length
Nature
Recombinant
Amino Acids
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Accession Number
NP_000336.1
Molecule Mass
~14.46 kDa
Tag
No tag
Conjugation
Unconjugated
Relevant Diseases
Alzheimer's Disease; Parkinson's Disease
Applications
WB; SDS-PAGE
Research Areas
Neuroregeneration
Form
Liquid
Formulation
PBS pH7.4
Carrier Protein
Preservative Free
Purification
Ion-exchange Purified
Purity
>95%
Shipping
Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Storage
-80°C
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson disease familial 1 Protein; SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse)
Uniprot ID
P37840 (Human); P37840 (Mouse)
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013).
2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.
3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.
4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.
5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.
Neural Proteins & Peptides
Animal Models
Neural Vectors
Kits
Neural Antibodies
Neural Cell Lines
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare