Creative Biolabs

Recombinant Human Alpha Synuclein Protein Monomer (Type 2) Protien

[CAT#: NPP2007FY57]

Species:
Human
Tag:
No tag

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Active human recombinant alpha-synuclein protein monomer (type 2)
Species
Human
Biological Activity
Thioflavin T curve shows less β-sheet aggregation when Type 2 monomers are seeded with PFFs compared to Type 1 monomers seeded with PFFs.
Expression Host
E. coli
Length
Full Length
Nature
Recombinant
Amino Acids
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Accession Number
NP_000336.1
Molecule Mass
~14.46 kDa
Tag
No tag
Conjugation
Unconjugated
Relevant Diseases
Alzheimer's Disease; Parkinson's Disease
Applications
WB; SDS-PAGE
Research Areas
Neuroregeneration
Form
Liquid
Formulation
PBS pH7.4
Carrier Protein
Preservative Free
Purification
Ion-exchange Purified
Purity
>95%
Shipping
Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Storage
-80°C
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson disease familial 1 Protein; SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse)
Uniprot ID
P37840 (Human); P37840 (Mouse)
1. "Genetics Home Reference: SNCA". US National Library of Medicine. (2013).
2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.
3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.
4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.
5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.
Animal Models
Neural Vectors
Neural Antibodies
Kits
Neural Proteins & Peptides
Neural Cell Lines
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare