Creative Biolabs

Recombinant Human BDNF Mature Protein, Animal Free [AA 129 to 247]

[CAT#: NPR2008PZ483]

Species:
Human

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
This product is the mature full length protein from aa 129 to 247. The signal peptide and propeptide are not included. Noncovalent homodimer.
Species
Human
Expression Host
Escherichia coli
Nature
Recombinant
Amino Acids
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR
Accession Number
P23560
Molecule Mass
27 kDa
Applications
SDS-PAGE; WB
Research Areas
Neurodegeneration
Pathways
Huntington's Disease Signaling
Form
Lyophilized
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Shipping
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile 0.2 micron filtered solution.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
Centrifuge vial before opening. Suspend the product by gently pipetting sterile water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
BDNF
Official Name
BDNF
Full Name
Brain Derived Neurotrophic Factor
Alternative Names
Brain Derived Neurotrophic Factor; Neurotrophin; Abrineurin; Brain-Derived Neurotrophic Factor; ANON2; BULN2;
Gene ID
627 (Human); 12064 (Mouse); 24225 (Rat)
Uniprot ID
P23560 (Human); P21237 (Mouse); P23363 (Rat)
Neural Proteins & Peptides
Neural Antibodies
Kits
Biomaterials
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare