Creative Biolabs

Recombinant Human BDNF Protein [AA 129 to 247]

[CAT#: NPR2008PZ481]

Species:
Human

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Non-glycosylated homodimer, containing two 119 amino acid chains.
Species
Human
Expression Host
Escherichia coli
Nature
Recombinant
Amino Acids
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR
Accession Number
P23560
Molecule Mass
27 kDa including tags
Applications
SDS-PAGE; WB
Research Areas
Neurodegeneration
Pathways
Huntington's Disease Signaling
Form
Lyophilized
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Shipping
Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acidLyophilised from a sterile filtered solution containing no additives.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
Reconstitute with Sterile water at 100µg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 °C and avoid repeat freeze thaws.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
BDNF
Official Name
BDNF
Full Name
Brain Derived Neurotrophic Factor
Alternative Names
Brain Derived Neurotrophic Factor; Neurotrophin; Abrineurin; Brain-Derived Neurotrophic Factor; ANON2; BULN2;
Gene ID
627 (Human); 12064 (Mouse); 24225 (Rat)
Uniprot ID
P23560 (Human); P21237 (Mouse); P23363 (Rat)
Kits
Neural Antibodies
Neural Proteins & Peptides
Biomaterials
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare