Creative Biolabs

Recombinant Human IL6 Protein, Biotin-Conjugated, Low Endotoxin

[CAT#: NPR2008PZ119]

Species:
Human
Sequence:
30 to 212

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
This product is for the mature full length protein. The signal peptide is not included. NP_000591.
Species
Human
Expression Host
HEK 293 cells
Nature
Recombinant
Sequence
30 to 212
Amino Acids
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCE SSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYL QNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKL QAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Accession Number
P05231
Molecule Mass
21 kDa
Conjugation
Biotin
Applications
FuncS; HPLC; MS; SDS-PAGE
Research Areas
Neurodegeneration
Pathways
Alzheimer's Disease Signaling
Marker
Others
Form
Lyophilized
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Endotoxin Level
< 1.000 Eu/µg
Shipping
Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituent: 100% PBSNote: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
Reconstitute with sterile deionized water to a concentration of 100 µg/ml.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
IL-6
Official Name
IL6
Full Name
Interleukin 6 (IL-6)
Alternative Names
IL6; BSF2; HGF; HSF; IFNB2; IL-6; BSF-2; CDF; IFN-beta-2; interleukin 6
Gene ID
3569(Human)
Uniprot ID
P05231(Human)
Neural Antibodies
Neural Proteins & Peptides
Neural Cell Lines
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare