Creative Biolabs

Recombinant Human SNCG Protein (N-His)

[CAT#: NPR2008PZ407]

Species:
Human
Sequence:
1 to 127
Tag:
N-His

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Species
Human
Expression Host
Escherichia coli
Nature
Recombinant
Sequence
1 to 127
Amino Acids
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQ SVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDL RPSAPQQEGEASKEKEEVAEEAQSGGD
Accession Number
O76070
Molecule Mass
18 kDa including tags
Tag
N-His
Applications
FuncS; SDS-PAGE; WB
Research Areas
Neurodegeneration
Pathways
Parkinson's Disease Signaling
Marker
Synuclein
Form
Liquid
Concentration
20 µg at 0.2 mg/ml50 µg at 0.2 mg/ml
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Shipping
Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycles.
pH: 7.00Preservative: 1.02% ImidazoleConstituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.76% Sodium chloride
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
This protein is filter sterilized prior to aliquoting and lyophilization. All aliquoting and lyophilization steps are performed in a sterile environment.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Gamma Synuclein
Official Name
SNCG
Full Name
gamma Synuclein
Alternative Names
SNCG; BCSG1; SR; synuclein gamma
Gene ID
6623(Human); 20618(Mouse); 64347(Rat)
Uniprot ID
O76070(Human); Q9Z0F7(Mouse); Q63544(Rat)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare