Creative Biolabs

Recombinant Mouse ANTXR2 Protein (C-His)

[CAT#: NPR2008PZ2244]

Species:
Mouse
Sequence:
32 to 318
Tag:
C-His

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Extracellular domain (NP_598499).
Species
Mouse
Expression Host
Baculovirus infected insect cells
Nature
Recombinant
Sequence
32 to 318
Amino Acids
QAQEQPSCKKAFDLYFVLDKSGSVANNWIEIYNFVHQLTERFVSPEMRLS FIVFSSQATIILPLTGDRYKIGKGLEDLKAVKPVGETYIHEGLKLANEQI QNAGGLKASSIIIALTDGKLDGLVPSYAENEAKKSRSLGASVYCVGVLDF EQAQLERIADSKDQVFPVKGGFQALKGIINSILAQSCTEILELSPSSVCV GEKFQVVLTGRAVTSISHDGSVLCTFTANSTYTKSEKPVSIQPSSILCPA PVLNKDGETLEVSISYNDGKSAVSRSLTITATECTNGLEHHHHHH
Accession Number
Q6DFX2
Molecule Mass
32 kDa including tags
Tag
C-His
Applications
FuncS; SDS-PAGE; WB
Research Areas
Cell Adhension Protein
Marker
Membrane Protein
Form
Liquid
Purity
>= 95% SDS-PAGE. Purity by HPLC>=95%.
Shipping
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituents: 10% Glycerol, PBS
Storage
12 months from date of receipt when stored at -20°C to -80°C as supplied. 1 month when stored at 4°C after reconstituting as directed. 3 months when stored at -20°C to -80°C after reconstituting as directed.

For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Handling Advice
This protein is filter sterilized prior to aliquoting and lyophilization. All aliquoting and lyophilization steps are performed in a sterile environment.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
ANTXR2
Official Name
ANTXR2
Full Name
Anthrax toxin receptor 2
Alternative Names
ANTXR2; CMG-2; CMG2; HFS; ISH; JHF; anthrax toxin receptor 2; ANTXR cell adhesion molecule 2
Gene ID
118429 (Human); 71914 (Mouse); 305633 (Rat)
Uniprot ID
P58335 (Human); Q6DFX2 (Mouse)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare