Creative Biolabs

Recombinant Rat Alpha Synuclein Protein

[CAT#: NPP2007FY262]

Active Rat Recombinant Alpha Synuclein Protein Preformed Fibrils

Species:
Rat
Tag:
No tag

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Description
Alpha-synuclein is a protein encoded by the SNCA gene in humans. It is high in the brain, but low in the heart, muscle and other tissues. In the brain, alpha-synuclein is mainly found at the tips of neurons with special structures called presynaptic terminals. In these structures, α-synuclein interacts with phospholipids and proteins. The presynaptic terminal releases chemical messengers called neurotransmitters from compartments called synaptic vesicles. The release of neurotransmitters transmits signals between neurons and is essential for normal brain function.
Species
Rat
Expression Host
E. coli
Length
Full Length
Amino Acids
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
Molecule Mass
14.515 kDa
Tag
No tag
Relevant Diseases
Alzheimer's Disease; Parkinson's Disease
Applications
WB; SDS-PAGE
Form
Liquid
Formulation
PBS pH 7.4
Purification
Ion-exchange Purified
Purity
>95%
Shipping
Dry Ice
Storage
-80°C
Handling Advice
Centrifuge the vial prior to opening.
Research Use Only
For research use only, not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse); 29219 (Rat)
Uniprot ID
P37840 (Human); P37840 (Mouse); P37377 (Rat)
Neural Proteins & Peptides
Neural Antibodies
Neural Genes
Biomaterials
Neural Cell Lines
Kits
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare