Creative Biolabs

SNCA Peptide (1-41 aa), Rat; Mouse; Porcine

[CAT#: NPP200701LS]

Species:
Rat; Mouse; Porcine
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVG

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Species
Rat; Mouse; Porcine
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVG
Construction
1-41 aa
Molecule Mass
4.2 kDa
Relevant Diseases
Alzheimer's Disease
Form
Powder
Purity
>95%, as determined by SDS-PAGE
Shipping
The product is shipped at 4°C. Upon receipt, store it immediately at the temperature recommended below.
Storage
Up to 6 months in lyophilized form at 0-5°C.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Handling Advice
Each vial contains 100 μg of NET peptide.
Research Use Only
For research use only; not for diagnostic or therapeutic use.
Target
Alpha Synuclein
Official Name
SNCA
Full Name
Alpha-synuclein
Alternative Names
SNCA; NACP; PARK1; PARK4; PD1; synuclein alpha
Gene ID
6622 (Human); 20617 (Mouse)
Uniprot ID
P37840 (Human); P37840 (Mouse)
1. Vinnakota RL, Yedlapudi D, Manda KM, et al. Identification of an Alternatively Spliced α-Synuclein Isoform That Generates a 41-Amino Acid N-Terminal Truncated Peptide, 41-syn: Role in Dopamine Homeostasis. ACS Chem Neurosci. 2018;
2. Moriarty GM, Olson MP, Atieh TB, Janowska MK, Khare SD, Baum J. J Biol Chem. 2017;
3. Sulzer D, Alcalay RN, Garretti F, et al. Nature. 2017;546(7660):656-661.
4. Al-hilaly YK, Biasetti L, Blakeman BJ, et al. Sci Rep. 2016;6:39171.
5. Choi MY, Kim YS, Lim D, et al. Biochem Biophys Res Commun. 2011;408(2):334-8.
Neural Genes
Neural Proteins & Peptides
Neural Antibodies
Kits
Neural Cell Lines
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare