iNeuMab™ Anti-Kv1.2 potassium channel subunit BBB Shuttle Antibody (NRZP-0423-ZP204)
[CAT#: NRZP-0423-ZP204]
- Species Reactivity:
- Human; Mouse; Rat
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
SPECIFIC INQUIRY
inquiryProduct Overview
Description
The BBB is a highly selective membrane that surrounds the blood vessels in the brain, and it can prevent many molecules, including potentially life-saving drugs, from entering the brain. The anti-KCNA2 BBB Shuttle Antibody is designed to bind to receptors on the surface of cells in the BBB, and once bound, the antibody can cross the BBB and into the brain. This technology has the potential to revolutionize the treatment of brain disorders by enabling drugs to reach the brain more effectively.
Immunogen
Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480)
Mouse: 100% identity (72/72 amino acids identical)
Rat: 100% identity (72/72 amino acids identical)
Some identity with Kv1.1, Kv1.3 and Kv1.4
Mouse: 100% identity (72/72 amino acids identical)
Rat: 100% identity (72/72 amino acids identical)
Some identity with Kv1.1, Kv1.3 and Kv1.4
Construction
We offer several options for BBB shuttle antibody design. Antibody construction can be customized according to customer requirements.
Species Reactivity
Human; Mouse; Rat
Clonality
Monoclonal
Isotype
IgG2a
Research Areas
K+ channels
Conjugation
Unconjugated
Product Properties
Research Use Only
For reseaech use only, not for human or dignostic use.
Target
Target
KCNA2
Official Name
KCNA2
Full Name
Kv1.2 K+ channel
Alternative Names
KCNA2; Potassium voltage-gated channel; shaker-related subfamily; member 2
Uniprot ID
P16389
Publications
Publications (0)
For Research Use Only. Not For Clinical Use.
Product
Hot Products
Antibodies
- iNeuMab™ Anti-SEZ6 Antibody (NRP-0422-P515) (Cat#: NRP-0422-P515)
- iNeuMab™ Anti-TREM2 Antibody (NRP-0422-P792) (Cat#: NRP-0422-P792)
- iNeuMab™ Anti-TREM2 BBB Shuttle Antibody (NRZP-1022-ZP4114) (Cat#: NRZP-1022-ZP4114)
- iNeuMab™ Anti-pTau Antibody (NRP-0422-P1719) (Cat#: NRP-0422-P1719)
- iNeuMab™ Anti-Alpha Synuclein BBB Shuttle Antibody (NRZP-1022-ZP4050) (Cat#: NRZP-1022-ZP4050)
- iNeuMab™ Anti-Tau Antibody (NRP-0422-P2293) (Cat#: NRP-0422-P2293)
- iNeuMab™ Anti-FGFR1 Antibody (NRP-0422-P1244) (Cat#: NRP-0422-P1244)
- iNeuMab™ Anti-Tau Antibody (NRP-0422-P1684) (Cat#: NRP-0422-P1684)
- iNeuMab™ Anti-EPHB2 Antibody (NRP-0422-P1220) (Cat#: NRP-0422-P1220)
- Mouse Anti-Human α-Synuclein Phospho (Tyr39) (CBP3706) (Cat#: NAB201250LS)
More
Cells
- Human Glial (Oligodendrocytic) Hybrid Cell Line (MO3.13) (Cat#: NCL-2108P34)
- Rat Schwann Cells RSC96, Immortalized (Cat#: NCL-2108P21)
- Mouse Retinal Ganglion Cell Line RGC-5 (Cat#: NCL2110P154)
- iNeu™ Human Sensory Neurons (Cat#: NCL-2103-P62)
- iNeu™ Human Neural Stem Cell Line (Cat#: NCL200552ZP)
- Rat Immortalized Retinal Muller Cell Line rMC-1 (Cat#: NCL-2106-S93)
- Human Blood Brain Barrier Model (Cat#: NCL-2103-P187)
- Mouse Retinal Ganglion Cells (Cat#: NCL2110P145)
- Rat Glioma Cell Line C6 (Cat#: NCL2110P346)
- Mouse Glioma Cell Line GL261 (Cat#: NCL-2108P28)
More
Kits
- Amyloid beta 1-42 Kit (Cat#: NRP-0322-P2170)
- Human Tau Aggregation Kit (Cat#: NRP-0322-P2173)
- Human Poly ADP ribose polymerase,PARP Assay Kit (Cat#: NRZP-1122-ZP62)
- Alpha-Synuclein Aggregation Assay Kit (Cat#: NRZP-1122-ZP37)
- Alpha Synuclein Aggregation Kit (Cat#: NRZP-1122-ZP15)
- Beta Amyloid (1-42), Aggregation Kit (Cat#: NRZP-0323-ZP200)
- Beta Amyloid (1-40), Aggregation Kit (Cat#: NRZP-0323-ZP199)
- Human GFAP ELISA Kit [Colorimetric] (Cat#: NPP2011ZP383)
More
Tracers
- AAV2 Full Capsids, Reference Standards (Cat#: NTC2101070CR)
- VSV-eGFP (Cat#: NTA-2011-ZP20)
- AAV2/9-hEF1a-fDIO-eNpHR 3.0-mCherry-WPRE-pA (Cat#: NTA-2012-ZP78)
- Dextran, NHS Activated (Cat#: NRZP-0722-ZP124)
More
Gene Related Products
- Human presenilin 1 (PSEN1), transcript variant 2 (NM_007318) ORF clone, TurboGFP Tagged (Cat#: NEP-0421-R0140)
- Lenti of Mouse synuclein, alpha (Snca) transcript variant (NM_001042451) ORF clone, mGFP Tagged (Cat#: NEP-0521-R0864)
- App Rat amyloid beta (A4) precursor protein (App)(NM_019288) ORF clone, Untagged (Cat#: NEP-0421-R0053)
- Human huntingtin-associated protein 1 (HAP1) transcript variant 2 (NM_177977) ORF clone, Myc-DDK Tagged (Cat#: NEP-0521-R0676)
- Human apolipoprotein E (APOE) (NM_000041) ORF clone, Untagged (Cat#: NEP-0421-R0232)
- Human huntingtin (HTT) (NM_002111) ORF clone, Myc-DDK Tagged (Cat#: NEP-0521-R0497)
- ABCA1 Antisense Oligonucleotide (NV-2106-P27) (Cat#: NV-2106-P27)
- Lenti of Human TAR DNA binding protein (TARDBP) (NM_007375) ORF clone, mGFP Tagged (Cat#: NEP-0521-R0832)
- Rat Parkinson disease (autosomal recessive, juvenile) 2, parkin (Park2) (NM_020093) ORF clone/lentiviral particle, Myc-DDK Tagged (Cat#: NEP-0621-R0041)
- Mouse Parkinson disease (autosomal recessive, early onset) 7 (Park7) (NM_020569) clone, Untagged (Cat#: NEP-0621-R0133)
More
Biospecimens
- NeuroBiologics™ Monkey Cerebrospinal Fluid (Cat#: NRZP-0822-ZP495)
- NeuroBiologics™ Pig Cerebrospinal Fluid (Cat#: NRZP-0822-ZP498)
- NeuroBiologics™ Rat Cerebrospinal Fluid (Cat#: NRZP-0822-ZP496)
- NeuroBiologics™ Mouse Cerebrospinal Fluid (Cat#: NRZP-0822-ZP497)
- NeuroBiologics™ Human Cerebrospinal Fluid (Cat#: NRZP-0822-ZP491)
More
Cell Assay Reagents
- NeuroPro™ Anti-GDNF BBB Shuttle Protein (Cat#: NRZP-0423-ZP500)
- NeuroPro™ Anti-TNFR BBB Shuttle Protein (Cat#: NRZP-0423-ZP510)
- NeuroPro™ Anti-ASA BBB Shuttle Protein (Cat#: NRZP-0423-ZP504)
- NeuroPro™ Anti-NAGLU BBB Shuttle Protein (Cat#: NRZP-0423-ZP506)
- NeuroPro™ Anti-GDNF BBB Shuttle Protein (Cat#: NRZP-0423-ZP509)
- NeuroPro™ Anti-IDUA BBB Shuttle Protein (Cat#: NRZP-0423-ZP498)
- NeuroPro™ Anti-PON1 BBB Shuttle Protein (Cat#: NRZP-0423-ZP507)
- NeuroPro™ Anti-Erythropoietin BBB Shuttle Protein (Cat#: NRZP-0423-ZP499)
- NeuroPro™ Anti-EPO BBB Shuttle Protein (Cat#: NRZP-0423-ZP508)
- NeuroPro™ Anti-IDS BBB Shuttle Protein (Cat#: NRZP-0423-ZP503)
More
