Creative Biolabs

Mouse Anti-Human UBQLN2 (555-624 aa) Monoclonal Antibody (Clone 5F5)

[CAT#: NAB210505SL]

Anti-UBQLN2 Monoclonal Antibody

Host Species:
Mouse
Species Reactivity:
Human
Applications:
IF; ELISA; WB

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
Immunogen: UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Construction
555-624 aa
Species Reactivity
Human
Clonality
Monoclonal
Host Species
Mouse
Isotype
IgG2a, kappa
Clone Number
5F5
Applications
IF; ELISA; WB
Application Notes
Optimal working dilution should be determined by the investigator.
Relevant Diseases
Amyotrophic Lateral Sclerosis
Conjugation
Unconjugated
Form
Liquid
Formulation
PBS containing 50 % glycerol, 0.5 % BSA and 0.02 % sodium azide.
Concentration
Lot specific
Purification
Affinity purified
Purity
>95%, as determined by Coomassie stained SDS-PAGE.
Shipping
The product is shipped at 4°C. Upon receipt, store it immediately at the recommended temperature. Avoid freeze/thaw cycles.
Storage
Store at -20°C. Upon initial thawing, apportion into working aliquots and store at -20°C. Avoid repeated freeze-thaw cycles to prevent denaturing the antibody.
Handling Advice
This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Research Use Only
Research Use Only
Target
Ubiquilin-2
Official Name
UBQLN2
Full Name
Ubiquilin-2
Alternative Names
bA431N15.1;
CHAP 1;
CHAP1;
CHAP1/DSK2;
Dsk 2;
Dsk2;
DSK2 homolog;
hPLIC 2;
hPLIC2;
HRIHFB2157;
LIC 2;
LIC2;
Gene ID
29978(Human); 54609(Mouse); 317396(Rat)
Uniprot ID
Q9UHD9(Human); Q9QZM0(Mouse)
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare