Creative Biolabs

Mouse Anti-Human TARDBP (1-260 aa) Monoclonal Antibody (Clone 2E2D3)

[CAT#: NAB210504SL]

Anti-TARDBP Monoclonal Antibody

Host Species:
Mouse
Species Reactivity:
Human
Applications:
IF; IHC; IP; ELISA; WB

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Bulk Quote
Immunogen
Immunogen: TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Construction
1-260 aa
Species Reactivity
Human
Clonality
Monoclonal
Host Species
Mouse
Isotype
IgG1, kappa
Clone Number
2E2D3
Applications
IF; IHC; IP; ELISA; WB
Application Notes
Optimal working dilution should be determined by the investigator.
Relevant Diseases
Amyotrophic Lateral Sclerosis
Conjugation
Unconjugated
Form
Liquid
Formulation
PBS containing 50 % glycerol, 0.5 % BSA and 0.02 % sodium azide.
Concentration
Lot specific
Purification
Affinity purified
Purity
>95%, as determined by Coomassie stained SDS-PAGE.
Shipping
The product is shipped at 4°C. Upon receipt, store it immediately at the recommended temperature. Avoid freeze/thaw cycles.
Storage
Store at -20°C. Upon initial thawing, apportion into working aliquots and store at -20°C. Avoid repeated freeze-thaw cycles to prevent denaturing the antibody.
Handling Advice
This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Research Use Only
Research Use Only
Target
TARDBP
Official Name
TARDBP
Full Name
TAR DNA Binding Protein
Alternative Names
TARDBP; ALS10; TDP-43; TAR DNA binding protein
Gene ID
Uniprot ID
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Go to compare