Name: iNeuMab™ Anti-SUR1 BBB Shuttle Antibody (NRZP-0423-ZP399)
SKU: NRZP-0423-ZP399
Rating: 5 (1 reviews)

Product Overview

Description

The BBB is a highly selective membrane that surrounds the blood vessels in the brain, and it can prevent many molecules, including potentially life-saving drugs, from entering the brain. The anti-Abcc8 BBB Shuttle Antibody is designed to bind to receptors on the surface of cells in the BBB, and once bound, the antibody can cross the BBB and into the brain. This technology has the potential to revolutionize the treatment of brain disorders by enabling drugs to reach the brain more effectively.

Immunogen

Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS, ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429) Mouse: 100% identity (35/35 amino acids identical)
Human: 94% identity (33/35 amino acids identical)
Similar % identity with other isoforms
>70% identity with SUR2B

Construction

We offer several options for BBB shuttle antibody design. Antibody construction can be customized according to customer requirements.

Species Reactivity

Mouse; Rat

Clonality

Monoclonal

Isotype

IgG1

Conjugation

Unconjugated

Product Properties

Research Use Only

For reseaech use only, not for human or dignostic use.

Target

Abcc8

Official Name

ABCC8

Full Name

SUR1

Alternative Names

AM60008PU-N Antibody, ABC36 Antibody, Abcc8 Antibody, ATP binding cassette sub family C member 8 Antibody, HHF1 Antibody, HRINS Antibody, MRP8 Antibody, PHHI Antibody, SUR Antibody, SUR1 Antibody, Sulfonylurea receptor (hyperinsulinemia) Antibody, ATP binding cassette sub family C (CFTR/MRP) member 8 Antibody, ATP binding cassette transporter sub family C member 8 (1) Antibody, ATP-binding cassette sub-family C member 8 Antibody, HI Antibody, PHHI Antibody, Sulfonylurea receptor 1 Antibody, SUR1delta2 Antibody, TNDM2 Antibody; ATP Binding Cassette Subfamily C Member 8; ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8; Sulfonylurea Receptor (Hyperinsulinemia); Sulfonylurea Receptor 1; HRINS; SUR1; SUR; ATP-Binding Cassette Transporter Sub-Family C Member 8; ATP-Binding Cassette Sub-Family C Member 8