Name: iNeuMab™ Anti-Nav1.2 sodium channel BBB Shuttle Antibody (NRZP-0423-ZP279)
SKU: NRZP-0423-ZP279
Rating: 5 (1 reviews)

Product Overview

Description

The BBB is a highly selective membrane that surrounds the blood vessels in the brain, and it can prevent many molecules, including potentially life-saving drugs, from entering the brain. The anti-SCN2A BBB Shuttle Antibody is designed to bind to receptors on the surface of cells in the BBB, and once bound, the antibody can cross the BBB and into the brain. This technology has the potential to revolutionize the treatment of brain disorders by enabling drugs to reach the brain more effectively.

Immunogen

Fusion protein amino acids 1882-2005 (cytoplasmic C-terminus, RFMASNPSKVSYEPI TTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEDEGTPIKEDIITD KLNENSTPEKTDVTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK) of rat Voltage-gated sodium channel subunit alpha Nav1.2, Sodium channel protein type 2 subunit alpha, Sodium channel protein brain II subunit alpha, HBSC II, NAC2, Scn2a, Scn2a1, Scn2a2, accession number P04775)
Mouse: 100% identity (124/124 amino acids identical)
Human: 94% identity (117/124 amino acids identical)
>60% identity with Nav1.1, Nav1.3 and Nav1.7

Construction

We offer several options for BBB shuttle antibody design. Antibody construction can be customized according to customer requirements.

Species Reactivity

Rat; Mouse; Human

Clonality

Monoclonal

Isotype

IgG2a

Research Areas

Na+ channels

Conjugation

Unconjugated

Product Properties

Research Use Only

For reseaech use only, not for human or dignostic use.

Target

SCN2A

Official Name

SCN2A

Full Name

Nav1.2 Na+ channel

Alternative Names

Sodium Voltage-Gated Channel Alpha Subunit 2; Sodium Channel; Voltage-Gated; Type II; Alpha 2 Polypeptide; Sodium Channel; Voltage-Gated; Type II; Alpha 1 Polypeptide; Sodium Channel; Voltage-Gated; Type II; Alpha Subunit; Voltage-Gated Sodium Channel Subunit Alpha Nav1.2; Sodium Channel Protein Brain II Subunit Alpha; Sodium Channel Protein Type II Subunit Alpha; HBSC II; SCN2A1; SCN2A2; NAC2; Sodium Channel; Voltage Gated; Type II Alpha Subunit; Sodium Channel Protein; Brain Type 2 Alpha Subunit;