Tel:
Fax:
Email:
Creative Biolabs
Product
Hot Products
Antibodies
Cells
Kits
Tracers
Gene Related Products
Biospecimens
Cell Assay Reagents

Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1) transcript variant 2 (NM_080648) ORF clone/Lentiviral Particle, Myc-DDK Tagged

[CAT#: NEP-0521-R0689]

Human Huntingtin-Associated Protein 1 (NM_080648) ORF clone/Lentiviral Particle, Myc-DDK Tagged

Target:
HAP1
Gene/Insert name:
HAP1
Type:
Expression Vector/ Viral Particle

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Inquiry
Product Overview

Description

This is a human HAP1 Myc-DDK tagged ORF clone expression plasmid or lentiviral particle, ready for transfecting into mammalian cells.

Gene/Insert Name

HAP1

Species

Human

Insert Size (bp)

954 bp

Tag

Myc-DDK

Type

Expression Vector/ Viral Particle

Vector

pCMV6-Entry

Vector Type

CMV

Virus Type

CMV

E. coli Selection

Kanamycin (25 ug/mL)

Cell Selection

Neomycin

ORF Nucleotide Sequence

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCATGCCGAAGCGTGGGAAAAAGGGAGCGGTGGCGGAAGACGGGGATGAGCTCAGGACAGAGCCAGAGGCCAAGAAGAGTAAGACGGCCGCAAAGAAAAATGACAAAGAGGCAGCAGGAGAGGGCCCAGCCCTGTATGAGGACCCCCCAGATCAGAAAACCTCACCCAGTGGCAAACCTGCCACACTCAAGATCTGCTCTTGGAATGTGGATGGGCTTCGAGCCTGGATTAAGAAGAAAGGATTAGATTGGGTAAAGGAAGAAGCCCCAGATATACTGTGCCTTCAAGAGACCAAATGTTCAGAGAACAAACTACCAGCTGAACTTCAGGAGCTGCCTGGACTCTCTCATCAATACTGGTCAGCTCCTTCGGACAAGGAAGGGTACAGTGGCGTGGGCCTGCTTTCCCGCCAGTGCCCACTCAAAGTTTCTTACGGCATAGGCGATGAGGAGCATGATCAGGAAGGCCGGGTGATTGTGGCTGAATTTGACTCGTTTGTGCTGGTAACAGCATATGTACCTAATGCAGGCCGAGGTCTGGTACGACTGGAGTACCGGCAGCGCTGGGATGAAGCCTTTCGCAAGTTCCTGAAGGGCCTGGCTTCCCGAAAGCCCCTTGTGCTGTGTGGAGACCTCAATGTGGCACATGAAGAAATTGACCTTCGCAACCCCAAGGGGAACAAAAAGAATGCTGGCTTCACGCCACAAGAGCGCCAAGGCTTCGGGGAATTACTGCAGGCTGTGCCACTGGCTGACAGCTTTAGGCACCTCTACCCCAACACACCCTATGCCTACACCTTTTGGACTTATATGATGAATGCTCGATCCAAGAATGTTGGTTGGCGCCTTGATTACTTTTTGTTGTCCCACTCTCTGTTACCTGCATTGTGTGACAGCAAGATCCGTTCCAAGGCCCTCGGCAGTGATCACTGTCCTATCACCCTATACCTAGCACTGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGACGATAAGGTTTAA

Protein Sequence

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLALTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Restriction Sites

SgfI-MluI

Application Notes

The clone can express a complete ORF with a certain tag. Different ways of expression depend on the specific nature of the gene.

Purification

Ion-exchange column purified

Research Areas

Neural Signal Transduction

Relevant Diseases

Huntington's Disease

Key Components

Transfection-ready dried plasmid DNA
Properties

Soluble In

Sterile water

Appearance

Solid

Shipping

Keep in suitable, closed containers for shipping.

Handling Advice

Avoid breathing vapors, mist or gas.

Storage

Store the suspended plasmid at-20°C. The DNA is stable for at least one year from date of shipping when stored at-20°C

Research Use Only

For research use only
Target Details

Target

HAP1

Official Name

HAP1

Full Name

Huntingtin-associated protein 1

Alternative Names

Huntingtin-associated protein 1 (neuroan 1); HAP1

Gene ID

15114(Mouse); 29430(Rat)

Uniprot ID

O35668(Mouse); P54256(Rat)
Publications

Publications (0)

gift-card

Related Products
Neural Antibodies
Neural Genes
For Research Use Only. Not For Clinical Use.
Fill out this form for a quote Inquiry Form Send Inquiry
Inquiry Basket
compare

Send inquiry