iNeuMab™ Mouse Anti-SLC17A7 Monoclonal Antibody (CBP7226)
VGluT1 Mouse Monoclonal Antibody
- Host Species:
 - Mouse
 
- Species Reactivity:
 - Mouse; Rat; Human
 
- Applications:
 - IHC-P; WB
 
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
SPECIFIC INQUIRY
inquiryImmunogen
Sequence: PSISEEERKYIEDAIGESAKLMNPLTKFSTP
Database link: Q9P2U7
Species Reactivity
Clonality
Host Species
Isotype
Clone Number
Applications
Research Areas
Marker
Conjugation
Formulation
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS
Purification
Purity
Endotoxin Level
Shipping
Storage
1 month, 2 to 8 °C under sterile conditions after reconstitution.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes: avoid repeated freeze-thaw cycles.
Research Use Only
Publications (0)
                                        
                                    
- iNeuMab™ Rabbit Anti-Alpha-synuclein (CBP1631) (Cat#: NAB-08-PZ079)
 - iNeuMab™ Rabbit Anti-LRRK2 Monoclonal Antibody (CBP1887) (Cat#: NAB-08-PZ735)
 - Mouse Anti-SCN5A Monoclonal Antibody (CBP708) (Cat#: NAB-0720-Z2720)
 - iNeuMab™ Mouse Anti-LRP1 Monoclonal Antibody (CBP3363) (Cat#: NAB-0720-Z6479)
 - iNeuMab™ Anti-F-Spondin/SPON1 Antibody, Clone 3F4 (Cat#: NRZP-0822-ZP4740)
 - iNeuMab™ Mouse Anti-SHANK3 Monoclonal Antibody (CBP929) (Cat#: NAB-0720-Z3477)
 - iNeuMab™ Mouse Anti-EFNB2 Monoclonal Antibody (CBP1159) (Cat#: NAB-0720-Z4396)
 - Mouse Anti-Human α-Synuclein Phospho (Tyr39) (CBP3706) (Cat#: NAB201250LS)
 
- Rat Muller Cell (Cat#: NCL2110P040)
 - Mouse Glioma Cell Line GL-261-Luc (Cat#: NCL-2108P06)
 - Human Blood Brain Barrier Model (Cat#: NCL-2103-P187)
 - Human Glial (Oligodendrocytic) Hybrid Cell Line (MO3.13) (Cat#: NCL-2108P34)
 - iNeu™ Human Sensory Neurons (Cat#: NCL-2103-P62)
 - Human Brain Vascular Adventitial Fibroblasts (Cat#: NCL-21P6-014)
 - Human Dental Pulp Stem Cells (Cat#: NRZP-1122-ZP113)
 - Human Microglia Cell Line HMC3, Immortalized (Cat#: NCL-2108P38)
 - Mouse Glioma Cell Line GL261 (Cat#: NCL-2108P28)
 - Rat Glioma Cell Line C6 (Cat#: NCL2110P346)
 
- Alpha-Synuclein Aggregation Assay Kit (Cat#: NRZP-1122-ZP37)
 - Human GFAP ELISA Kit [Colorimetric] (Cat#: NPP2011ZP383)
 - Alpha Synuclein Aggregation Kit (Cat#: NRZP-1122-ZP15)
 - Amyloid beta 1-42 Kit (Cat#: NRP-0322-P2170)
 - Beta Amyloid (1-42), Aggregation Kit (Cat#: NRZP-0323-ZP200)
 - Beta Amyloid (1-40), Aggregation Kit (Cat#: NRZP-0323-ZP199)
 - Human Tau Aggregation Kit (Cat#: NRP-0322-P2173)
 - Human Poly ADP ribose polymerase,PARP Assay Kit (Cat#: NRZP-1122-ZP62)
 
- VSV-eGFP (Cat#: NTA-2011-ZP20)
 - AAV2 Full Capsids, Reference Standards (Cat#: NTC2101070CR)
 - Dextran, NHS Activated (Cat#: NRZP-0722-ZP124)
 
- Tau Antisense Oligonucleotide (IONIS-MAPTRx) (Cat#: NV-2106-P29)
 - App Rat amyloid beta (A4) precursor protein (App)(NM_019288) ORF clone, Untagged (Cat#: NEP-0421-R0053)
 - Rat Parkinson disease (autosomal recessive, juvenile) 2, parkin (Park2) (NM_020093) ORF clone/lentiviral particle, Myc-DDK Tagged (Cat#: NEP-0621-R0041)
 - Lenti of Human TAR DNA binding protein (TARDBP) (NM_007375) ORF clone, mGFP Tagged (Cat#: NEP-0521-R0832)
 - Human huntingtin (HTT) (NM_002111) ORF clone, Myc-DDK Tagged (Cat#: NEP-0521-R0497)
 - Mouse Parkinson disease (autosomal recessive, early onset) 7 (Park7) (NM_020569) clone, Untagged (Cat#: NEP-0621-R0133)
 - Human superoxide dismutase 3, extracellular (SOD3) (NM_003102) ORF clone, Untagged (Cat#: NEP-0521-R0808)
 - ABCA1 Antisense Oligonucleotide (NV-2106-P27) (Cat#: NV-2106-P27)
 - Human apolipoprotein E (APOE) (NM_000041) ORF clone, Untagged (Cat#: NEP-0421-R0232)
 - Human huntingtin-associated protein 1 (HAP1) transcript variant 2 (NM_177977) ORF clone, Myc-DDK Tagged (Cat#: NEP-0521-R0676)
 
- NeuroBiologics™ Monkey Cerebrospinal Fluid (Cat#: NRZP-0822-ZP495)
 - NeuroBiologics™ Mouse Cerebrospinal Fluid (Cat#: NRZP-0822-ZP497)
 - NeuroBiologics™ Human Cerebrospinal Fluid (Cat#: NRZP-0822-ZP491)
 - NeuroBiologics™ Rat Cerebrospinal Fluid (Cat#: NRZP-0822-ZP496)
 - NeuroBiologics™ Pig Cerebrospinal Fluid (Cat#: NRZP-0822-ZP498)
 
- NeuroPro™ Anti-idursulfase BBB Shuttle Protein (Cat#: NRZP-0423-ZP497)
 - NeuroPro™ Anti-SGSH BBB Shuttle Protein (Cat#: NRZP-0423-ZP505)
 - NeuroPro™ Anti-Erythropoietin BBB Shuttle Protein (Cat#: NRZP-0423-ZP499)
 - NeuroPro™ Anti-GDNF BBB Shuttle Protein (Cat#: NRZP-0423-ZP509)
 - NeuroPro™ Anti-EPO BBB Shuttle Protein (Cat#: NRZP-0423-ZP508)
 - NeuroPro™ Anti-IDS BBB Shuttle Protein (Cat#: NRZP-0423-ZP503)
 - NeuroPro™ Anti-ASA BBB Shuttle Protein (Cat#: NRZP-0423-ZP504)
 - NeuroPro™ Anti-NAGLU BBB Shuttle Protein (Cat#: NRZP-0423-ZP506)
 - NeuroPro™ Anti-GDNF BBB Shuttle Protein (Cat#: NRZP-0423-ZP500)
 - NeuroPro™ Anti-IDUA BBB Shuttle Protein (Cat#: NRZP-0423-ZP498)
 
