Tel:
Fax:
Email:
Creative Biolabs

iNeuMab™ Mouse Anti-NLGN3 Monoclonal Antibody (CBP1231)

[CAT#: NAB-0720-Z4622]

Neuroligin 3 Mouse Monoclonal Antibody

Host Species:
Mouse
Species Reactivity:
Mouse; Rat; Human
Applications:
WB; IHC-P; IHC-Fr; ICC; IF

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Inquiry

SPECIFIC INQUIRY

inquiry
Size:
Conjugation:
Endotoxin:
Purity:
Engineering:
Product Overview

Immunogen

Fusion protein corresponding to Rat Neuroligin 3 aa 730-848 (C terminal). Accession no AAA97871
Sequence: YYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTHHECEAGP PHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNT FAAGFNSTGLPNSHSTTRV
Database link: Q62889

Species Reactivity

Mouse; Rat; Human

Clonality

Monoclonal

Host Species

Mouse

Isotype

IgG1

Clone Number

CBP1231

Applications

WB; IHC-P; IHC-Fr; ICC; IF

Research Areas

Neurogenesis

Pathways

Neurogenesis Signaling

Conjugation

Unconjugated; APC; PE; HRP; Biotin; FITC
Product Properties

Form

Liquid

Formulation

pH: 7.40
Preservative: 0.1% Sodium azide
Constituents: 49% PBS, 50% Glycerol

Purification

Protein G purified

Purity

>95%

Endotoxin Level

Low Endotoxin

Shipping

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

Storage

12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes: avoid repeated freeze-thaw cycles.

Research Use Only

NAB-0720-Z4622 is designed for research use only, not for diagnostic or therapeutic use.
Target

Target

Neuroligin 3

Official Name

NLGN3

Full Name

Neuroligin 3

Alternative Names

NLGN3; HNL3; neuroligin 3

Gene ID

54413(Human)

Uniprot ID

Q9NZ94(Human)
Publications

Publications (0)

gift-card

Related Products
For Research Use Only. Not For Clinical Use.
Products
Hot Products
Fill out this form for a quote Inquiry Form Send Inquiry
USA

Tel:

Fax:

Email:

UK

Tel:

Email:

Germany

Tel:

Email:

Inquiry Basket
compare

Send inquiry