Tel:
Fax:
Email:
Creative Biolabs

iNeuMab™ Anti-mGluR1 Antibody (CBP11026)

[CAT#: NRZP-0822-ZP3927]

Host Species:
Mouse
Species Reactivity:
Human
Applications:
WB; ELISA; S-ELISA

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Inquiry

SPECIFIC INQUIRY

inquiry
Size:
Conjugation:
Endotoxin:
Purity:
Engineering:
Product Overview

Immunogen

GRM1 (NP_000829, 387 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY

Species Reactivity

Human

Clonality

Monoclonal

Host Species

Mouse

Isotype

IgG2b Kappa

Clone Number

CBP11026

Applications

WB; ELISA; S-ELISA

Conjugation

Unconjugated
Product Properties

Purification

Protein A or G purified

Storage

Store at -20°C. Do not aliquot the antibody.

Research Use Only

For research use only
Target

Target

GRM1

Official Name

GRM1

Full Name

glutamate metabotropic receptor 1

Alternative Names

MGLU1; SCA44; GPRC1A; MGLUR1; SCAR13; PPP1R85

Gene ID

2911(Human)

Uniprot ID

Q13255(Human)
Publications

Publications (0)

gift-card

Related Products
For Research Use Only. Not For Clinical Use.
Products
Hot Products
Fill out this form for a quote Inquiry Form Send Inquiry
USA

Tel:

Fax:

Email:

UK

Tel:

Email:

Germany

Tel:

Email:

Inquiry Basket
compare

Send inquiry