Tel:
Fax:
Email:
Creative Biolabs

Lenti of Rat myelin basic protein (Mbp) transcript variant 4 (NM_001025294) ORF clone, Myc-DDK Tagged

[CAT#: NEP-0521-R0381]

Rat Myelin Basic Protein (MBP) (NM_001025294) ORF clone, Myc-DDK Tagged

Target:
Myelin Basic Protein
Gene/Insert name:
MBP
Type:
Expression Vector/ Viral Particle

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Inquiry
Product Overview

Description

This is a rat MBP Myc-DDK tagged ORF clone expression plasmid, ready for transfecting into mammalian cells.

Gene/Insert Name

MBP

Species

Rat

Insert Size (bp)

474 bp

Tag

Myc-DDK

Type

Expression Vector/ Viral Particle

Vector

pLenti

E. coli Selection

Chloramphenicol (34 ug/mL)

Cell Selection

Puromycin

ORF Nucleotide Sequence

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCATGGCATCACAGAAGAGACCCTCACAGCGACACGGATCCAAGTACTTGGCCACAGCAAGTACCATGGACCATGCCCGGCATGGCTTCCTCCCAAGGCACAGAGACACGGGCATCCTTGACTCCATCGGGCGCTTCTTTAGCGGTGACAGGGGTGCGCCCAAGCGGGGCTCTGGCAAGGACTCACACACAAGAACTACCCACTACGGCTCCCTGCCCCAGAAGTCGCAGAGGACCCAAGATGAAAACCCAGTAGTCCACTTCTTCAAGAACATTGTGACACCTCGTACACCCCCTCCATCCCAAGGAAAGGGGGCCGAGGGGCAGAAGCCAGGATTTGGCTACGGAGGCAGAGCTTCCGACTATAAATCGGCTCACAAGGGATTCAAGGGGGCCTACGACGCCCAGGGCACGCTTTCCAAAATCTTTAAGCTGGGAGGAAGAGACAGCCGCTCTGGATCTCCCATGGCAAGACGCACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGACGATAAGGTTTAA

Protein Sequence

MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQRTQDENPVVHFFKNIVTPRTPPPSQGKGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKLGGRDSRSGSPMARRTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Restriction Sites

SgfI-MluI

Application Notes

The clone can express a complete ORF with a certain tag. Different ways of expression depend on the specific nature of the gene.

Purification

Ion-exchange column purified

Research Areas

Neural Signal Transduction; Metabolism

Relevant Diseases

Parkinson's Disease; Neurodegenerative Disease

Key Components

Transfection-ready dried plasmid DNA
Properties

Soluble In

Sterile water

Appearance

Solid

Shipping

Keep in suitable, closed containers for shipping.

Handling Advice

Avoid breathing vapors, mist or gas.

Storage

Store the suspended plasmid at-20°C. The DNA is stable for at least one year from date of shipping when stored at-20°C

Research Use Only

For research use only
Target Details

Target

Myelin Basic Protein

Official Name

MBP

Full Name

Myelin basic protein

Alternative Names

MBP; entrez:4155; myelin basic protein; Myelin basic protein; Myelin_BP; IPR000548

Gene ID

4155(Human); 17196(Mouse); 24547(Rat)

Uniprot ID

P02686(Human); P04370(Mouse); P02688(Rat)
Publications

Publications (0)

gift-card

Related Products
Neural Genes
Neural Antibodies
For Research Use Only. Not For Clinical Use.
Products
Hot Products
Fill out this form for a quote Inquiry Form Send Inquiry
USA

Tel:

Fax:

Email:

UK

Tel:

Email:

Germany

Tel:

Email:

Inquiry Basket
compare

Send inquiry