Tel:
Fax:
Email:
Creative Biolabs
Product

Mouse Anti-PLXNA1 Monoclonal Antibody (CBP842)

[CAT#: NAB-0720-Z3247]

Plexin A1 Mouse Monoclonal Antibody

Host Species:
Mouse
Species Reactivity:
Human
Applications:
WB; FC

Datasheet MSDS Request COA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Inquiry

SPECIFIC INQUIRY

inquiry
Size:
Conjugation:
Endotoxin:
Purity:
Engineering:
Product Overview

Immunogen

Recombinant fragment corresponding to Human Plexin A1 aa 1100-1200. Expressed in E.coli.
Sequence: TTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPD PVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTL T
Database link: Q9UIW

Species Reactivity

Human

Clonality

Monoclonal

Host Species

Mouse

Isotype

IgG2b

Clone Number

CBP842

Applications

WB; FC

Application Notes

WB (1:500-1:2000); FCM (1:200-1:400)

Research Areas

Neuroregeneration

Conjugation

Unconjugated
Product Properties

Formulation

Preservative: 0.05% Sodium azide
Constituent: PBS

Purification

Protein G purified

Purity

>95%

Shipping

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

Storage

12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
Notes: avoid repeated freeze-thaw cycles.

Research Use Only

For research use only, not for diagnostic or therapeutic use.
Target

Target

Plexin A1

Official Name

PLXNA1

Full Name

Plexin-A1

Alternative Names

PLXNA1; NOV; NOVP; PLEXIN-A1; PLXN1; Plexin A1

Gene ID

5361(Human); 18844(Mouse); NCBI: NP_115618(Rat)

Uniprot ID

Q9UIW2(Human); P70206(Mouse)
Publications

Publications (0)

gift-card

Related Products
For Research Use Only. Not For Clinical Use.
Send Inquiry Send Inquiry
Inquiry Basket
compare

Send inquiry